PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627547.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 165aa    MW: 18854.8 Da    PI: 10.7119
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627547.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.11e-131663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l+  +++ G g+ ++ ++  g+ R++k+c++rw +yl
   XP_009627547.1 16 KGPWTPAEDLKLISFIQKNGHGNRRSLPKQAGLLRSGKSCRLRWINYL 63
                     79******************************99************97 PP

2Myb_DNA-binding46.96.1e-1569112146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+eE+e +++++  lG++ W++Ia++++ gRt+++ k+ w++
   XP_009627547.1  69 RGNFTPEEEETIIKLHDSLGNR-WSKIASYFP-GRTDNENKNVWNT 112
                      89********************.*********.******9999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-21766IPR009057Homeodomain-like
PROSITE profilePS5129412.8361163IPR017930Myb domain
SuperFamilySSF466893.51E-2714110IPR009057Homeodomain-like
SMARTSM007171.6E-81565IPR001005SANT/Myb domain
PfamPF002491.6E-111663IPR001005SANT/Myb domain
CDDcd001673.62E-71863No hitNo description
PROSITE profilePS5129423.74764118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2467117IPR009057Homeodomain-like
SMARTSM007172.3E-1168116IPR001005SANT/Myb domain
PfamPF002491.5E-1369113IPR001005SANT/Myb domain
CDDcd001671.15E-871112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MGKGRAPCCD KSKVKKGPWT PAEDLKLISF IQKNGHGNRR SLPKQAGLLR SGKSCRLRWI  60
NYLRPDVKRG NFTPEEEETI IKLHDSLGNR WSKIASYFPG RTDNENKNVW NTQLKKRVGI  120
LKKDIKINTT TQEAFETNNK GQYIDVATSI NIKEGLGKMM WPLIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-25161184105C-Myb DNA-Binding Domain
1mse_C1e-25161184105C-Myb DNA-Binding Domain
1gv2_A1e-25161184105MYB PROTO-ONCOGENE PROTEIN
1a5j_A2e-25161187108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2448031e-34AC244803.1 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-8f2 map 10, complete sequence.
GenBankAC2449371e-34AC244937.1 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone sle-8f2 map 10, complete sequence.
GenBankHG9754491e-34HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755221e-34HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627547.11e-120PREDICTED: myb-related protein Myb4-like
SwissprotP200243e-61MYB1_MAIZE; Myb-related protein Zm1
TrEMBLK4CX872e-73K4CX87_SOLLC; Uncharacterized protein
STRINGSolyc10g005550.1.15e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.18e-70myb domain protein 58